Bio-Computational Prediction of Novel Epitopes on VP2 Protein of Infectious Bursal Disease Virus
Niraj K Singh, Anuj Tyagi, Sumit Singhal, Anjay, Yogendra Singh Jadoun, Anuradha Kumari
Journal of Advances in Microbiology · pp. 26–39 · Published 2 Jun 2024
10.9734/jamb/2024/v24i5824Abstract
Aim: Recently, many viral Immunogenic peptides or epitopes have been used as potential vaccine and also immuno-diagnostic candidates. In this study, we predicted different epitopic peptides on VP2 protein of infectious bursal disease virus (IBDV) using bioinformatics tools, which can be potential vaccine as well as diagnostic candidate for IBD, in future. Study Design: In the present study, B-cell epitopes (linear or continuous, and conformational) and T-cell epitopes were predicted on VP2 protein. Place and Duration of Study: Bihar Animal Sciences University, Patna, and Guru Angad Dev Veterinary and Animal Sciences University, Ludhiana, India between June and December 2023. Methodology: For the prediction of linear B-cell epitopes, Bepipred Linear Epitope Prediction 2.0, SVMTriP, and BCPred tools were used, while Ellipro was used for conformational B-cell epitopes prediction. In the absence of immune-bioinformatics tool is available to predict poultry MHC-peptide binding, only those human MHC-I/II alleles having greater than 70% identities those of poultry MHC-I/II alleles were selected. NetMHCcons 1.1 and NetMHCIIpan - 4.0 tools were used to predict strong binding affinity of peptides with MHC-I and MHC-II, respectively. Results: As per analysis by four different tools, the peptide ‘SYDLGYVRLGDPIPAIGLDPKMV ATCDSSDRPRVYTITAADDYQFSSQYQPGGV164-217’ (EpitopeL) was predicted as the most prominent linear B-cell epitope. Two peptides, i.e. ANLNSPLKIAG (EpitopeC 1) and SSQYQPGGRTSVHGLGLTTGTDKSGGQAGDQMS (EpitopeC 2) were predicted as potent conformational B-cell epitopes. During T-cell epitopes prediction, human HLA*B 40:06, HLA*B 41:03 and HLA*B 41:04 alleles chosen as homologues of poultry MHC class I alleles while DRB1:1310, DRB1:1366, DRB1:1445, and DRB1:1482 chosen as homologues of poultry MHC class II alleles. A 9-mer GELVFQTSV236-244 peptide was predicted as MHC-I strong binder ability while, two 15-mer peptides, i.e. YTKLILSERDRLGIK389-403 and QMLLTAQNLPASYNY76-90 were predicted as MHC-II strong binder ability. Conclusion: Using bio-computational analysis, one linear and two conformational B-cell epitopes were predicted on VP2 protein of IBDV. During T-cell epitopes prediction one 9-mer peptide and two 15-mer peptides were predicted as MHC-I and MHC-II strong binding peptides, respectively. After assessing protective immune responses through in vitro and in vivo studies, these predicted peptides could be potential candidates for developing subunit vaccines.
References (27)
- 1 BepiPred-2.0: improving sequence-based B-cell epitope prediction using conformational epitopes [DOI]
- 2 ElliPro: a new structure-based tool for the prediction of antibody epitopes [DOI]
- 3 A semi‐empirical method for prediction of antigenic determinants on protein antigens [DOI]
- 4 Predicting linear B‐cell epitopes using string kernels [DOI]
- 5 Peptide Vaccine: Progress and Challenges [DOI]
- 6 Acute infectious bursal disease in poultry: A review [DOI]
- 7 SVMTriP: A Method to Predict Antigenic Epitopes Using Support Vector Machine to Integrate Tri-Peptide Similarity and Propensity [DOI]
- 8 Understanding modern-day vaccines: what you need to know [DOI]
- 9 Accurate pan-specific prediction of peptide-MHC class II binding affinity with improved binding core identification [DOI]
- 10 An introduction to epitope prediction methods and software [DOI]
- 11 MHCcluster, a method for functional clustering of MHC molecules [DOI]
- 12 Infectious bursal disease virus in chickens: prevalence, impact, and management strategies [DOI]
- 13 Diagnosing Infectious Diseases in Poultry Requires a Holistic Approach: A Review [DOI]
- 14 VP1, the Putative RNA-Dependent RNA Polymerase of Infectious Bursal Disease Virus, Forms Complexes with the Capsid Protein VP3, Leading to Efficient Encapsidation into Virus-Like Particles [DOI]
- 15 C Terminus of Infectious Bursal Disease Virus Major Capsid Protein VP2 Is Involved in Definition of the T Number for Capsid Assembly [DOI]
- 16 Infectious Bursal Disease Virus-Host Interactions: Multifunctional Viral Proteins that Perform Multiple and Differing Jobs [DOI]
- 17 Autoproteolytic Activity Derived from the Infectious Bursal Disease Virus Capsid Protein [DOI]
- 18 Design of a predicted MHC restricted short peptide immunodiagnostic and vaccine candidate for Fowl adenovirus C in chicken infection [DOI]
- 19 Practical Aspects of Poultry Vaccination [DOI]
- 20 In Silico Identification of Epitopes in Mycobacterium avium subsp. paratuberculosis Proteins That Were Upregulated under Stress Conditions [DOI]
- 21 In silico epitope prediction and immunogenic analysis for penton base epitope-focused vaccine against hydropericardium syndrome in chicken [DOI]
- 22 Evaluation of four enzyme linked immunosorbent assays for the detection of antibodies to infectious bursal disease in chickens [DOI]
- 23 In silico homology modelling and prediction of novel epitopic peptides from P24 protein of Haemonchus contortus [DOI]
- 24 The Use of Peptides in Veterinary Serodiagnosis of Infectious Diseases: A Review [DOI]
- 25 The Influence of an Acidifier Feed Additive on Biochemical Parameters and Immune Response of Broilers [DOI]
- 26 An In-silico Study Showing Potentials of Selected Anthocyanin Derivatives against Uropathogenic E. coli Adhesin Protein [DOI]
- 27 D431N Mutant VP2 Protein of Infectious Bursal Disease Virus; Derived T=1 Particles [DOI]
Cited by 0
No indexed citations yet.
Related research
- Insilico Prediction of T-cell Epitopes to Therapeutic Interferon -Beta (IFN-β) Protein — shares topic coverage
- Computational Identification and Immunoinformatic Design of a Multiepitope Vaccine Candidate against Marburg Virus Disease Using Reverse Vaccinology — shares topic coverage
- In silico Prediction of Promiscuous HLA Class I and II T-Cell Epitopes from MED12 for Therapeutic Vaccine Development against Breast Phyllodes Tumours — shares topic coverage
- Genetic Analysis of Infectious Bursal Disease Virus (IBDV) from a Farm in Vom, Plateau State, Nigeria — shares topic coverage
- Comparison of the Immunogenicity and Pathogenicity of a Genetically Engineered Infectious Bursal Disease Virus Vaccine and Two Commercial Live Vaccines in Chickens with Maternal Antibodies — shares topic coverage
Article metrics
Real usage data collected on this platform.
58
Page views
0
PDF downloads
10
Outbound clicks
0
Citations
Views over time
Views by country
Approximate, from request IP at view time — not citizenship or institution. Countries with fewer than 5 views are grouped as "Other".
Traffic sources
Referring site, by host.
Views and downloads exclude known bots/crawlers. Citations combines this platform's own DOI-resolved index with each external source's own reported total — see Cited by above for individually listed citing works. Last refreshed 0 seconds ago.